@ARTICLE{TreeBASE2Ref23946,
author = {Zhu Hai feng and Wang Hua and Zhu Yi fang and Zou Jian wen and Zhao Fang jie and Huang Chao feng},
title = {Genome-wide transcriptomic and phylogenetic analyses reveal distinct aluminum-tolerance mechanisms in the aluminum-accumulating species buckwheat (Fagopyrum tataricum) },
year = {2015},
keywords = {aluminum tolerance, Al-tolerance genes, buckwheat, homolog, organic acid, transcriptome},
doi = {},
url = {http://},
pmid = {},
journal = {BioMed Central},
volume = {},
number = {},
pages = {},
abstract = {Background
Similar to common buckwheat (Fagopyrum esculentum), tartary buckwheat (Fagopyrum tataricum) shows a high level of aluminum (Al) tolerance and accumulation. However, the molecular mechanisms for Al detoxification and accumulation are still poorly understood. To begin to elucidate the molecular basis of Al tolerance and accumulation, we used the Illumina high-throughput mRNA sequencing (RNA-seq) technology to conduct a genome-wide transcriptome analysis on both tip and basal segments of the roots exposed to Al.
Results
By using the Trinity method for the de novo assembly and cap3 software to reduce the redundancy and chimeras of the transcripts, we constructed 39,815 transcripts with an average length of 1184 bp, among which 20,605 transcripts were annotated by BLAST searches in the NCBI non-redundant protein database. Gene Ontology (GO) and Kyoto Encyclopedia of Genes and Genomes (KEGG) enrichment analysis showed that genes involved in the defense of cell wall toxicity and oxidative stress were preferentially induced in expression by Al stress. Our RNA-seq data also revealed that organic acid metabolism was unlikely to be a rate-limiting step for the Al-induced secretion of organic acids in buckwheat. We identified two citrate transporter genes that were highly induced by Al and potentially involved in the release of citrate into the xylem. In addition, three of four conserved Al-tolerance genes were found to be duplicated in tartary buckwheat and display diverse expression patterns.
Conclusions
Nearly 40,000 high quality transcript contigs were de novo assembled for tartary buckwheat, providing a reference platform for future research work in this plant species. Our differential expression and phylogenetic analysis revealed novel aspects of Al-tolerant mechanisms in buckwheat.
}
}
Matrix 25150 of Study 16751

Citation title:
"Genome-wide transcriptomic and phylogenetic analyses reveal distinct aluminum-tolerance mechanisms in the aluminum-accumulating species buckwheat (Fagopyrum tataricum) ".

Study name:
"Genome-wide transcriptomic and phylogenetic analyses reveal distinct aluminum-tolerance mechanisms in the aluminum-accumulating species buckwheat (Fagopyrum tataricum) ".

This study is part of submission 16751
(Status: Published).
Matrices
Title: Fagopyrum STAR1
Rows
|
Taxon Label |
Row Segments |
Characters 1?–30 |
| Fagopyrum tataricum STOL1 |
(none)
|
CALYCFHIKLSSLPLTASYFYELTAMSARE |
| Fagopyrum tataricum STOL2 |
(none)
|
------PQKIQQP------------MAPSL |
| Vitis vinifera CAN70271 |
(none)
|
------------------------------ |
| Populus trichocarpa XP_002325227 |
(none)
|
------------------------------ |
| Solanum tuberosum XP_006366268 |
(none)
|
------------------------------ |
| Arabidopsis thaliana STAR1 |
(none)
|
----------------------------MP |
| Aegilops tauschii EMT05468 |
(none)
|
------------------------------ |
| Setaria italica XP_004966143 |
(none)
|
------------------------------ |
| Triticum uraatu EMS52544 |
(none)
|
------------------------------ |
| Oryza sativa Japonica Group STAR1 |
(none)
|
MRIARIPTSIPPHLRLPLDLSAVSPMGSAS |
Columns
None of the columns has a description.