@ARTICLE{TreeBASE2Ref27524,
author = {Jun Xu and Guilin Wang and Jing Wang and Yongqing Li and Liangliang Tian and Xinyu Wang and Wangzhen Guo},
title = {The lysin motif-containing proteins, Lyp1, Lyk7 and LysMe3, play important roles in chitin perception and defense against Verticillium dahliae in cotton},
year = {2017},
keywords = {Lysin motif; Pattern recognition receptors; Plasma membrane localization; Chitin signals; Verticillium dahliae; Cotton},
doi = {},
url = {http://},
pmid = {},
journal = {BMC Plant Biology},
volume = {},
number = {},
pages = {},
abstract = {Background: Lysin motif (LysM)-containing proteins are important pattern recognition receptors (PRRs) in plants and function in the perception of microbe-associated molecular patterns (MAMPs) and in the defense against pathogenic attack. To date, the LysM genes have not been systematically analyzed in cotton or effectively utilized for disease resistance.
Results: Here, we identified 29, 30, 60, and 56 LysM genes in the four sequenced cotton species, diploid Gossypium raimondii, diploid G. arboreum, tetraploid G. hirsutum acc. TM-1, and G. barbadense acc. 3-79, respectively. These LysM genes were classified into four groups with different structural characteristics and a variety of expression patterns in different organs and tissues when induced by chitin or Verticillium dahliae. We further characterized three genes, Lyp1, Lyk7 and LysMe3, which showed significant increase in expression in response to chitin signals, V. dahliae challenge and several stress-related signaling compounds. Lyp1, Lyk7 and LysMe3 proteins were localized to the plasma membrane, and silencing of their expression in cotton drastically impaired salicylic acid, jasmonic acid, and reactive oxygen species generation, impaired defense gene activation, and compromised resistance to V. dahliae.
Conclusion: Our results indicate that Lyp1, Lyk7, and LysMe3 are important PRRs that function in the recognition of chitin signals to activate the downstream defense processes and induce cotton defense mechanisms against V. dahliae.}
}
Matrix 44019 of Study 21420

Citation title:
"The lysin motif-containing proteins, Lyp1, Lyk7 and LysMe3, play important roles in chitin perception and defense against Verticillium dahliae in cotton".

Study name:
"The lysin motif-containing proteins, Lyp1, Lyk7 and LysMe3, play important roles in chitin perception and defense against Verticillium dahliae in cotton".

This study is part of submission 21420
(Status: Published).
Matrices
Title: Fig.S1A Lyks
Rows
|
Taxon Label |
Row Segments |
Characters 1?–30 |
| Gossypium raimondii GrLyk1 |
(none)
|
---MLITMVSLSHHLLACLSLPLL------ |
| Gossypium raimondii GrLyk2 |
(none)
|
-----MDPKVSQFVILLPLISLLI------ |
| Gossypium raimondii GrLyk3 |
(none)
|
---MSKIYLRALVLLIWLLISPLG------ |
| Gossypium raimondii GrLyk4 |
(none)
|
------MRTKLSYVFVFCLLFFVF------ |
| Gossypium raimondii GrLyk5 |
(none)
|
----MRIKPHQQVFFSWFLILFLF------ |
| Gossypium raimondii GrLyk6 |
(none)
|
MAISFLSHQWQSLQVVFFVLNYVF------ |
| Gossypium raimondii GrLyk7 |
(none)
|
-MAVGRLKPCLKFCLPFLLLFFLGFTQAQQ |
| Gossypium raimondii GrLyk8 |
(none)
|
-----MDQFRFGFFILLCVFMHKFHAQQSY |
Columns
None of the columns has a description.